SP-17 Protein, Human (His)
Based on 1 Customer Validation
The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag.
Background
SP-17 protein serves as a crucial sperm surface binding protein, facilitating the high-affinity attachment of spermatozoa to the zona pellucida. Its role suggests involvement in the binding of zona pellucida and carbohydrates, emphasizing its significance in the fertilization process. The protein exists in a homodimeric form and may potentially interact with ROPN1, contributing to the intricate molecular interactions essential for successful sperm-egg binding during fertilization.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
Q15506 (M1-K151)
-
Molecular Construction
-
N-term
-
8*His
-
SP-17 (M1-K151)
Accession # Q15506 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SPA17; Cancer/Testis Antigen 22; Sperm Autoantigenic Protein 17; Sperm Protein 17; SP17; SP17-1; CT22; Sp17-1; Sperm Surface Protein Sp17
-
AA Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCL, pH 8.0, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
