SP-D Protein, Rhesus Macaque (HEK293, His)

The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived SP-D protein, expressed by HEK293 , with C-His labeled tag.

The SP-D protein plays a crucial role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. It engages with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby influencing leukocyte activity in the immune response. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of respiratory function. The protein exhibits a strong binding affinity for maltose residues and, to a lesser extent, other alpha-glucosyl moieties. Notably, SP-D forms an oligomeric complex comprising four sets of homotrimers, emphasizing its structural organization in facilitating its diverse functions (

Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The experiment was incubated at 37 ℃ for 2 h. The ED₅₀ for this effect is 1.43 μg/mL.

• 
  Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The experiment was incubated at 37 ℃ for 2 h. The ED₅₀ for this effect is 1.43 μg/mL.

Rhesus Macaque

HEK293

C-His

Q1PBC5/NP_001035283.1 (D22-F375)

678657  [NCBI]

Full Length of Mature Protein

DMKTYSQRTAPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGKAGMPGEAGPVGPKGDNGSIGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGPAGPKGDRGVPGERGAPGNAGAAGSAGVMGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQKQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAALQQLVIAQNEAAFLSMTDSKMEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Approximately 40-50 kDa due to the glycosylation

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.