SPG21 Protein, Human (sf9, His)

The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

The SPG21 protein is suggested to potentially function as a negative regulatory factor in CD4-dependent T-cell activation, indicating its involvement in modulating immune responses. It interacts with CD4, suggesting a molecular association that may impact CD4-mediated T-cell activation pathways. Additionally, SPG21 interacts with ALDH16A1, indicating its potential participation in cellular processes associated with the aldehyde dehydrogenase family. The specific mechanisms underlying SPG21's regulatory role in T-cell activation and its interaction with ALDH16A1 remain areas of interest, highlighting its potential significance in immune regulation and cellular metabolism.

Human

Sf9 insect cells

N-6*His

Q9NZD8-1 (M1-Q308)

51324  [NCBI]

Full Length of Isoform-1

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.