SPG21 Protein, Human (sf9, His)
Based on 1 Customer Validation
The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
The SPG21 protein is suggested to potentially function as a negative regulatory factor in CD4-dependent T-cell activation, indicating its involvement in modulating immune responses. It interacts with CD4, suggesting a molecular association that may impact CD4-mediated T-cell activation pathways. Additionally, SPG21 interacts with ALDH16A1, indicating its potential participation in cellular processes associated with the aldehyde dehydrogenase family. The specific mechanisms underlying SPG21's regulatory role in T-cell activation and its interaction with ALDH16A1 remain areas of interest, highlighting its potential significance in immune regulation and cellular metabolism.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-6*His
-
Accession
Q9NZD8-1 (M1-Q308)
-
Molecular Construction
-
N-term
-
6*His
-
SPG21 (M1-Q308)
Accession # Q9NZD8-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SPG21; MAST; SPG21 Abhydrolase Domain Containing, Maspardin; Spastic Paraplegia 21 (Autosomal Recessive, Mast Syndrome); ACP33; Acid Cluster Protein 33; Maspardin; SPG21, Maspardin; BM-019; Spastic Paraplegia 21 Autosomal Recessive Mast Syndrome Protein;
-
AA Sequence
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
-
Predicted Molecular Mass
35 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
