SPG21 Protein, Mouse (sf9, His)

Customer Review

Based on 1 Customer Validation

The SPG21 protein acts as a negative regulator in CD4-dependent T cell activation, suggesting a potential role in the regulation of immune responses. By interacting directly with CD4, it affects key components of the T cell activation pathway. SPG21 Protein, Mouse (sf9, His) is the recombinant mouse-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SPG21 protein acts as a negative regulator in CD4-dependent T cell activation, suggesting a potential role in the regulation of immune responses. By interacting directly with CD4, it affects key components of the T cell activation pathway. SPG21 Protein, Mouse (sf9, His) is the recombinant mouse-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

The SPG21 protein appears to function as a negative regulatory factor in CD4-dependent T-cell activation, suggesting a potential role in modulating immune responses. This regulatory function involves direct interactions with CD4, emphasizing its influence on key components of the T-cell activation pathway. Additionally, SPG21 protein interacts with ALDH16A1, indicating its involvement in diverse molecular interactions that may extend beyond T-cell regulation. Further exploration into the specific mechanisms and downstream effects of SPG21 in the context of CD4-dependent T-cell activation could provide valuable insights into its role in immune modulation and cellular processes beyond the immune system.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • SPG21 (M1-P308)
      Accession # Q9CQC8-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SPG21; MAST; SPG21 Abhydrolase Domain Containing, Maspardin; Spastic Paraplegia 21 (Autosomal Recessive, Mast Syndrome); ACP33; Acid Cluster Protein 33; Maspardin; SPG21, Maspardin; BM-019; Spastic Paraplegia 21 Autosomal Recessive Mast Syndrome Protein;

  • AA Sequence

    MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFQQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP

  • Predicted Molecular Mass

    35 kDa

  • Molecular Weight

    Approximately 52 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, 50% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00