1. Recombinant Proteins
  2. Others
  3. SPIN4 Protein, Human

The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human is the recombinant human-derived SPIN4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human is the recombinant human-derived SPIN4 protein, expressed by E. coli , with tag free.

Background

SPIN4 protein showcases H3K4me3-binding activity, indicating its affinity for histone H3 trimethylated at lysine 4. This unique binding ability suggests a potential role for SPIN4 in recognizing specific chromatin modifications, implicating it in the regulation of gene expression or chromatin dynamics. Additionally, SPIN4 interacts with C11orf84/SPINDOC, indicating a potential partnership or functional association with this interacting protein. These molecular interactions underscore the intricate involvement of SPIN4 in epigenetic processes and protein-protein interactions, hinting at its potential significance in cellular regulation and chromatin-related functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q56A73 (S2-P249)

Gene ID

139886

Molecular Construction
N-term
SPIN4 (S2-P249)
Accession # Q56A73
C-term
Protein Length

Partial

Synonyms
SPIN4; Spindlin-4
AA Sequence

SPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SPIN4 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPIN4 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPIN4 Protein, Human
Cat. No.:
HY-P701841
Quantity:
MCE Japan Authorized Agent: