SPINK4 Protein, Mouse (HEK293, Fc)
The SPINK4 protein is specifically expressed in the intestine, suggesting a potential role in gastrointestinal physiology.Its local expression implies involvement in digestive system processes, regulation of protease activity, or other functions critical to intestinal homeostasis.SPINK4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SPINK4 protein is specifically expressed in the intestine, suggesting a potential role in gastrointestinal physiology.Its local expression implies involvement in digestive system processes, regulation of protease activity, or other functions critical to intestinal homeostasis.SPINK4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SPINK4 protein is expressed specifically in the intestinal tract, suggesting a potential role in gastrointestinal physiology. The localized expression in the intestinal tract implies involvement in processes related to the digestive system, where it may contribute to the regulation of protease activity or other functions crucial for intestinal homeostasis. The specificity of SPINK4 expression in this particular tissue underscores its likely significance in the context of intestinal function, emphasizing its potential as a key player in maintaining the balance of molecular processes within the gastrointestinal environment. Further exploration is warranted to fully comprehend the functional implications of SPINK4 in intestinal health and its potential contributions to digestive processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
O35679 (G27-C86)
-
Molecular Construction
-
N-term
-
SPINK4 (G27-C86)
Accession # O35679 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPINK4; MGC133107; Serine Peptidase Inhibitor Kazal Type 4; Serine Peptidase Inhibitor, Kazal Type 4; PEC-60; Serine Protease Inhibitor, Kazal Type 4; Serine Protease Inhibitor Kazal-Type 4; Gastrointestinal Peptide; Epididymis Luminal Protein 136; HEL136
-
AA Sequence
GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC
-
Predicted Molecular Mass
34.5 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
