1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. SPINK4 Protein, Mouse (HEK293, Fc)

The SPINK4 protein is specifically expressed in the intestine, suggesting a potential role in gastrointestinal physiology.Its local expression implies involvement in digestive system processes, regulation of protease activity, or other functions critical to intestinal homeostasis.SPINK4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SPINK4 protein is specifically expressed in the intestine, suggesting a potential role in gastrointestinal physiology.Its local expression implies involvement in digestive system processes, regulation of protease activity, or other functions critical to intestinal homeostasis.SPINK4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

SPINK4 protein is expressed specifically in the intestinal tract, suggesting a potential role in gastrointestinal physiology. The localized expression in the intestinal tract implies involvement in processes related to the digestive system, where it may contribute to the regulation of protease activity or other functions crucial for intestinal homeostasis. The specificity of SPINK4 expression in this particular tissue underscores its likely significance in the context of intestinal function, emphasizing its potential as a key player in maintaining the balance of molecular processes within the gastrointestinal environment. Further exploration is warranted to fully comprehend the functional implications of SPINK4 in intestinal health and its potential contributions to digestive processes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O35679 (G27-C86)

Gene ID
Molecular Construction
N-term
SPINK4 (G27-C86)
Accession # O35679
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Serine Protease Inhibitor Kazal-Type 4; Peptide PEC-60 Homolog; SPINK4
AA Sequence

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Predicted Molecular Mass
34.5 kDa
Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SPINK4 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPINK4 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPINK4 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76084
Quantity:
MCE Japan Authorized Agent: