SPINK4 Protein, Mouse (HEK293, Fc)

The SPINK4 protein is specifically expressed in the intestine, suggesting a potential role in gastrointestinal physiology.Its local expression implies involvement in digestive system processes, regulation of protease activity, or other functions critical to intestinal homeostasis.SPINK4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-hFc labeled tag.

SPINK4 protein is expressed specifically in the intestinal tract, suggesting a potential role in gastrointestinal physiology. The localized expression in the intestinal tract implies involvement in processes related to the digestive system, where it may contribute to the regulation of protease activity or other functions crucial for intestinal homeostasis. The specificity of SPINK4 expression in this particular tissue underscores its likely significance in the context of intestinal function, emphasizing its potential as a key player in maintaining the balance of molecular processes within the gastrointestinal environment. Further exploration is warranted to fully comprehend the functional implications of SPINK4 in intestinal health and its potential contributions to digestive processes.

Mouse

HEK293

C-hFc

O35679 (G27-C86)

20731  [NCBI]

Full Length of Mature Protein

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.