Copy Link Print Information

Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His)

Customer Review

Based on 1 Customer Validation

Spondin-2/SPON2 protein, as a cell adhesion molecule, plays a key role in promoting the adhesion and growth of hippocampal embryonic neurons.In addition to its role in neurodevelopment, SPON2 acts as a direct binder of bacteria and their components, functioning as an opsonin to promote phagocytosis of bacteria by macrophages.Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Spondin-2/SPON2 protein, as a cell adhesion molecule, plays a key role in promoting the adhesion and growth of hippocampal embryonic neurons.In addition to its role in neurodevelopment, SPON2 acts as a direct binder of bacteria and their components, functioning as an opsonin to promote phagocytosis of bacteria by macrophages.Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with His labeled tag.

Background

Spondin-2, also known as SPON2, is a versatile cell adhesion protein crucial for hippocampal embryonic neuron adhesion and outgrowth. Its functional diversity extends to binding bacteria and their components, serving as an opsonin that facilitates macrophage phagocytosis of bacteria. Essential in initiating the innate immune response, SPON2 acts as a unique pattern-recognition molecule in the extracellular matrix (ECM) for microbial pathogens, specifically binding bacterial lipopolysaccharide (LPS). Existing as a monomer, SPON2 interacts with integrins, further emphasizing its role in mediating cell-matrix interactions (

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9BUD6 (Q27-V331)

  • Gene ID
    10417
  • Molecular Construction
    • N-term
    • SPON2 (Q27-V331)
      Accession # Q9BUD6
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SPON2; Spondin 2, Extracellular Matrix Protein; Spondin 2; M-Spondin; DIL1; Spondin-2; Mindin; DIL-1; Differentially Expressed In Cancerous And Non-Cancerous Lung Cells 1

  • AA Sequence

    QPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

  • Predicted Molecular Mass

    33.4 kDa

  • Molecular Weight

    Approximately 40-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) Product Image
    1/16
  • Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) Product Image