Copy Link Print Information

SPR Protein, Human (His)

Customer Review

Based on 1 Customer Validation

SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human (His) is the recombinant human-derived SPR protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SPR Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SPR proteins play a key role in tetrahydrobiopterin biosynthesis by catalyzing the final one or two reductions required to form 5,6,7,8-tetrahydrobiopterin. This enzyme activity is critical for the production of tetrahydrobiopterin, a cofactor involved in various biochemical pathways, including neurotransmitter synthesis and nitric oxide production. SPR Protein, Human (His) is the recombinant human-derived SPR protein, expressed by E. coli , with N-6*His labeled tag.

Background

Sapropterin reductase (SPR) is an enzyme that plays a crucial role in the biosynthesis of tetrahydrobiopterin (BH4). Specifically, SPR catalyzes the final one or two reductions in the tetrahydrobiopterin biosynthetic pathway, ultimately forming 5,6,7,8-tetrahydrobiopterin. This co-factor is essential for the activity of aromatic amino acid hydroxylases, which are involved in the synthesis of neurotransmitters and other bioactive molecules. The catalytic activity of SPR is vital for maintaining appropriate levels of tetrahydrobiopterin, which, in turn, influences the proper functioning of various physiological processes, including neurotransmitter production. Dysregulation of BH4 biosynthesis can impact neurotransmitter homeostasis and has been implicated in certain neurological disorders. It has to succinctly outline SPR's role in the final steps of tetrahydrobiopterin biosynthesis, underscoring its importance in supporting crucial biochemical pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P35270 (M1-K261)

  • Gene ID
    6697
  • Molecular Construction
    • N-term
    • 6*His
    • SPR (M1-K261)
      Accession # P35270
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SPR; Sepiapterin Reductase (7,8-Dihydrobiopterin:NADP+ Oxidoreductase); Sepiapterin Reductase; Sepiapterin Reductase (L-Erythro-7,8-Dihydrobiopterin Forming); SDR38C1; Short Chain Dehydrogenase/Reductase Family 38C, Member 1

  • AA Sequence

    MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

  • Predicted Molecular Mass

    30 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SPR Protein, Human (His) Product Image
    1/16
  • SPR Protein, Human (His) Product Image