SPRR4 Protein, Mouse (His)

SPRR4 Protein, Mouse (His) is the recombinant mouse-derived SPRR4 protein, expressed by E. coli, with C-6*His tag.

SPRR4 is a cross-linked envelope protein of keratinocytes, involved in UV-induced cornification (by similar).

Mouse

E. coli

C-6*His

Q8CGN8 (M1-K76)

229569

Full Length

MPSHQHQNQQQCTPQAQQQQVKQPCQPPPTKCQEACVPKTKDPCVPQAKKQCPARSTTNPAQEKCPAQQDPKCKQK

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.