SPRR4 Protein, Mouse (His)
Based on 1 Customer Validation
SPRR4 Protein, Mouse (His) is the recombinant mouse-derived SPRR4 protein, expressed by E. coli, with C-6*His tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SPRR4 Protein, Mouse (His) is the recombinant mouse-derived SPRR4 protein, expressed by E. coli, with C-6*His tag.
Background
SPRR4 is a cross-linked envelope protein of keratinocytes, involved in UV-induced cornification (by similar).
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
Q8CGN8 (M1-K76)
-
Gene ID229569
-
Molecular Construction
-
N-term
-
SPRR4 (M1-K76)
Accession # Q8CGN8 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SPRR4; Small Proline-Rich Protein 4; Small Proline Rich Protein 4
-
AA Sequence
MPSHQHQNQQQCTPQAQQQQVKQPCQPPPTKCQEACVPKTKDPCVPQAKKQCPARSTTNPAQEKCPAQQDPKCKQK
-
Predicted Molecular Mass
15.4 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)