SPT16 Protein, Arabidopsis thaliana
SPT16 Protein, Arabidopsis thaliana is the recombinant SPT16, expressed by E. coli , with tag Free labeled tag. ,
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SPT16 Protein, Arabidopsis thaliana is the recombinant SPT16, expressed by E. coli , with tag Free labeled tag. ,
Background
SPT16 is a component of the FACT complex, a general chromatin factor that reorganizes nucleosomes. The FACT complex is involved in multiple DNA-templated processes such as mRNA elongation, DNA replication, and DNA repair. During transcription elongation, the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates RNA polymerase II passage and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes nucleosome reestablishment after RNA polymerase II passage (Probable).
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
O82491 (L662-L952)
-
Gene ID826665
-
Protein Length
Partial
-
Synonyms
SUPT16H; FLJ10857; SPT16 Homolog, Facilitates Chromatin Remodeling Subunit; HSPT16; FACTP140; FACT; SPT16/CDC68; Suppressor Of Ty 16 Homolog (S. Cerevisiae); CDC68; Suppressor Of Ty (S.Cerevisiae) 16 Homolog; Chromatin-Specific Transcription Elongation Fa
-
AA Sequence
LVTQEKLQLAGNKFKPLRLSELWIRPPFSGRKKIPGTLEAHANGFRYSTTRPDERVDVLFANIKHAFFQPAEKEMITLLHFHLHNHIMVGTKKTKDVQFYVEVMDVVQSLGGGRRSAYDPDEIDEEQRERDRKNKINMDFNHFANRVNDMWQLPQFASLDLEFDQPLRELGFHGVPHKTSAFIIPTSSCLVELIEYPFLVVSLSEIEIVNLERVGFGQKNFDMAIIFKDFKKDVLRVDSVPTSSLEGIKEWLDTTDIKYYESKLNLNWRQILKTITDDPQSFIDDGGWEFL
-
Predicted Molecular Mass
33.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
