1. Recombinant Proteins
  2. Others
  3. SPT16 Protein, Arabidopsis thaliana

SPT16 Protein, Arabidopsis thaliana is the recombinant SPT16, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPT16 Protein, Arabidopsis thaliana is the recombinant SPT16, expressed by E. coli , with tag Free labeled tag. ,

Background

SPT16 is a component of the FACT complex, a general chromatin factor that reorganizes nucleosomes. The FACT complex is involved in multiple DNA-templated processes such as mRNA elongation, DNA replication, and DNA repair. During transcription elongation, the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates RNA polymerase II passage and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes nucleosome reestablishment after RNA polymerase II passage (Probable).

Species

Others

Source

E. coli

Tag

Tag Free

Accession

O82491 (L662-L952)

Gene ID

826665

Protein Length

Partial

Synonyms
FACT complex subunit SPT16; Facilitates chromatin transcription complex subunit SPT16; SPT16; Arabidopsis thaliana; Mouse-ear cress
AA Sequence

LVTQEKLQLAGNKFKPLRLSELWIRPPFSGRKKIPGTLEAHANGFRYSTTRPDERVDVLFANIKHAFFQPAEKEMITLLHFHLHNHIMVGTKKTKDVQFYVEVMDVVQSLGGGRRSAYDPDEIDEEQRERDRKNKINMDFNHFANRVNDMWQLPQFASLDLEFDQPLRELGFHGVPHKTSAFIIPTSSCLVELIEYPFLVVSLSEIEIVNLERVGFGQKNFDMAIIFKDFKKDVLRVDSVPTSSLEGIKEWLDTTDIKYYESKLNLNWRQILKTITDDPQSFIDDGGWEFL

Predicted Molecular Mass
33.9 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SPT16 Protein, Arabidopsis thaliana Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPT16 Protein, Arabidopsis thaliana

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPT16 Protein, Arabidopsis thaliana
Cat. No.:
HY-P703421
Quantity:
MCE Japan Authorized Agent: