Sting1/TMEM173 Protein, Human (P. pastoris, His)
The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM173 protein, expressed by P. pastoris , with C-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. Sting1/TMEM173 Protein, Human (P. pastoris, His) is the recombinant human-derived TMEM173 protein, expressed by P. pastoris , with C-6*His labeled tag.
Background
The TMEM173 protein acts as a facilitator of innate immune signaling, functioning as a sensor for cytosolic DNA from bacteria and viruses, ultimately promoting the production of type I interferon (IFN-alpha and IFN-beta). This innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. TMEM173 recognizes and binds cyclic dinucleotides, specifically cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol. Upon binding to c-di-GMP or cGAMP, TMEM173 oligomerizes, translocates from the endoplasmic reticulum, and is phosphorylated by TBK1, leading to the recruitment and activation of the transcription factor IRF3. This induces the expression of type I interferon, establishing a potent anti-viral state. Additionally, TMEM173 plays a direct role in autophagy, with cGAMP-binding initiating ERGIC formation, which serves as the membrane source for autophagosome formation, targeting cytosolic DNA or DNA viruses for lysosomal degradation. The multifaceted activities of TMEM173 highlight its central role in orchestrating innate immune responses and autophagic processes, contributing to the cell's defense against viral and bacterial threats.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag C-6*His
-
Accession
Q86WV6 (G135-S379)
-
Gene ID340061
-
Molecular Construction
-
N-term
-
TMEM173 (G135-S379)
Accession # Q86WV6 -
6*His
-
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
STING1; HSTING; Prev. TMEM173; N-Terminal Methionine-Proline-Tyrosine-Serine Plasma Membrane Tetraspanner; Transmembrane Protein 173; Stimulator Of Interferon Response CGAMP Interactor-DeltaC; STING; Stimulator Of Interferon Response CGAMP Interactor-Delt
-
AA Sequence
GLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
-
Predicted Molecular Mass
29.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)