Syndecan-1/CD138 Protein, Mouse (HEK293, C-His)

Measured by the ability of the immobilized protein to enhance the adhesion of Saos‑2 human osteosarcoma cells to human Fibronectin. The ED₅₀ for this effect is 1.533 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 652.316 units/mg.

Mouse

HEK293

C-10*His

P18828-1/NP_035649.1 (Q23-E252)

20969

Extracellular Domain

QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE

Approximately 43-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.