Copy Link Print Information

Syndecan-1/CD138 Protein, Mouse (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

Syndecan-1/CD138 Protein, a cell surface proteoglycan, connects the cytoskeleton to the interstitial matrix. It collaborates with SDCBP and PDCD6IP to regulate exosome biogenesis. It induces its own expression in dental cells through an MSX1 pathway. It interacts with CDCP1 and TIAM1, binding to the PDZ domain of TIAM1. It also interacts with MDK, impacting cellular processes. Syndecan-1/CD138, Mouse (HEK293, C-His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293, with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Syndecan-1/CD138 Protein, Mouse (HEK293, C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Syndecan-1/CD138 Protein, a cell surface proteoglycan, connects the cytoskeleton to the interstitial matrix. It collaborates with SDCBP and PDCD6IP to regulate exosome biogenesis. It induces its own expression in dental cells through an MSX1 pathway. It interacts with CDCP1 and TIAM1, binding to the PDZ domain of TIAM1. It also interacts with MDK, impacting cellular processes. Syndecan-1/CD138, Mouse (HEK293, C-His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293, with N-10*His labeled tag.

Background

Syndecan-1/CD138 Protein is a cell surface proteoglycan that incorporates both heparan sulfate and chondroitin sulfate, playing a crucial role in connecting the cytoskeleton to the interstitial matrix. It collaborates with SDCBP and PDCD6IP to regulate the biogenesis of exosomes. Additionally, Syndecan-1/CD138 Protein has the ability to trigger its own expression in dental mesenchymal cells and neighboring dental epithelial cells through an MSX1-mediated pathway. It interacts with CDCP1 and TIAM1, specifically binding to the PDZ domain of TIAM1 via its C-terminus. Furthermore, Syndecan-1/CD138 Protein interacts with MDK, contributing to various cellular processes.

Verified Bioactivity

Measured by the ability of the immobilized protein to enhance the adhesion of Saos‑2 human osteosarcoma cells to human Fibronectin. The ED50 for this effect is 1.533 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 652.316 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    P18828-1/NP_035649.1 (Q23-E252)

  • Gene ID
    20969
  • Molecular Construction
    • N-term
    • Syndecan-1/CD138 (Q23-E252)
      Accession # P18828-1/NP_035649.1
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SDC1; CD138; Prev. SDC; CD138 Antigen; SYND1; Syndecan-1; Syndecan; Heparan Sulfate Proteoglycan Fibroblast Growth Factor Receptor; Syndecan 1; Syndecan Proteoglycan 1

  • AA Sequence

    QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE

  • Predicted Molecular Mass

    25.3 kDa

  • Molecular Weight

    Approximately 43-75 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Syndecan-1/CD138 Protein, Mouse (HEK293, C-His) Product Image
    1/16
  • Syndecan-1/CD138 Protein, Mouse (HEK293, C-His) Product Image