1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD138/Syndecan-1 B Cell CD Proteins Stem Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution)

Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution)

Cat. No.: HY-P76101
Handling Instructions Technical Support

Syndecan-1, encoded by SDC1, is involved in myoblast development and engages in protein-protein interactions critical for cellular functions. Its location on the cell surface suggests a role in cell communication and signaling. Syndecan-1's broad expression profile across various tissues underscores its significance in different physiological contexts. Its evolutionary conservation with human SDC1 highlights its fundamental role across species. Syndecan-1/CD138 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Syndecan-1, encoded by SDC1, is involved in myoblast development and engages in protein-protein interactions critical for cellular functions. Its location on the cell surface suggests a role in cell communication and signaling. Syndecan-1's broad expression profile across various tissues underscores its significance in different physiological contexts. Its evolutionary conservation with human SDC1 highlights its fundamental role across species. Syndecan-1/CD138 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293 , with C-His labeled tag.

Background

Syndecan-1, encoded by the SDC1 gene, is predicted to play a role in myoblast development, demonstrating its involvement in fundamental cellular processes. It is anticipated to interact with identical proteins and bind to the C-terminus of other proteins, suggesting its engagement in protein-protein interactions critical for cellular functions. As a cell surface protein, Syndecan-1 is located on the external side of the plasma membrane, emphasizing its potential role in cell communication and signaling. The broad expression profile across various tissues, including the alimentary system, egg cylinder, sensory organ, skin, and urinary system, underscores its significance in diverse physiological contexts. The evolutionary conservation of Syndecan-1, as evidenced by its orthologous relationship with human SDC1, emphasizes its fundamental and conserved role across species.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

P18828-1/NP_035649.1 (Q23-E252)

Gene ID
Molecular Construction
N-term
Syndecan-1/CD138 (Q23-E252)
Accession # P18828-1/NP_035649.1
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
Syndecan-1; SYND1; CD138; SDC1; SDC
AA Sequence

QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE

Molecular Weight

45-60 kDa

Glycosylation
Yes
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution)
Cat. No.:
HY-P76101
Quantity:
MCE Japan Authorized Agent: