Copy Link Print Information

Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Syndecan-1, encoded by SDC1, is involved in myoblast development and engages in protein-protein interactions critical for cellular functions. Its location on the cell surface suggests a role in cell communication and signaling. Syndecan-1's broad expression profile across various tissues underscores its significance in different physiological contexts. Its evolutionary conservation with human SDC1 highlights its fundamental role across species. Syndecan-1/CD138 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Syndecan-1, encoded by SDC1, is involved in myoblast development and engages in protein-protein interactions critical for cellular functions. Its location on the cell surface suggests a role in cell communication and signaling. Syndecan-1's broad expression profile across various tissues underscores its significance in different physiological contexts. Its evolutionary conservation with human SDC1 highlights its fundamental role across species. Syndecan-1/CD138 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Syndecan-1/CD138 protein, expressed by HEK293 , with C-His labeled tag.

Background

Syndecan-1, encoded by the SDC1 gene, is predicted to play a role in myoblast development, demonstrating its involvement in fundamental cellular processes. It is anticipated to interact with identical proteins and bind to the C-terminus of other proteins, suggesting its engagement in protein-protein interactions critical for cellular functions. As a cell surface protein, Syndecan-1 is located on the external side of the plasma membrane, emphasizing its potential role in cell communication and signaling. The broad expression profile across various tissues, including the alimentary system, egg cylinder, sensory organ, skin, and urinary system, underscores its significance in diverse physiological contexts. The evolutionary conservation of Syndecan-1, as evidenced by its orthologous relationship with human SDC1, emphasizes its fundamental and conserved role across species.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    P18828-1/NP_035649.1 (Q23-E252)

  • Gene ID
    20969  [NCBI]
  • Molecular Construction
    • N-term
    • Syndecan-1/CD138 (Q23-E252)
      Accession # P18828-1/NP_035649.1
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SDC1; CD138; Prev. SDC; CD138 Antigen; SYND1; Syndecan-1; Syndecan; Heparan Sulfate Proteoglycan Fibroblast Growth Factor Receptor; Syndecan 1; Syndecan Proteoglycan 1

  • AA Sequence

    QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE

  • Predicted Molecular Mass

    25.4 kDa

  • Molecular Weight

    Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution) Product Image
    1/16
  • Syndecan-1/CD138 Protein, Mouse (HEK293, His, solution) Product Image