T4 gp32 Protein, T4 phage (His, Myc)
Based on 1 Customer Validation
T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His, Myc) is the recombinant T4 gp32 protein, expressed by E. coli , with N-His, C-Myc labeled tag. T4 gp32 Protein, T4 phage (His, Myc), has molecular weight of 41.8 kDa.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His, Myc) is the recombinant T4 gp32 protein, expressed by E. coli , with N-His, C-Myc labeled tag. T4 gp32 Protein, T4 phage (His, Myc), has molecular weight of 41.8 kDa.
Background
T4 gp32, a single-stranded DNA-binding protein, actively participates in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it coats the lagging-strand single-stranded DNA, providing essential support to the advancing replication fork. This versatile protein stimulates the activities of the viral DNA polymerase and the DnaB-like SF4 replicative helicase, likely through its interaction with the helicase assembly factor. T4 gp32, in collaboration with the replicative helicase and the helicase assembly factor, facilitates the pairing of homologous DNA molecules, mediates homologous DNA strand exchange, and promotes the formation of joint molecules. Acting as an mRNA-specific autogenous translational repressor, T4 gp32 exhibits a dynamic oligomeric state, forming homodimers in the absence of DNA and monomers upon DNA binding. It is an integral part of the replicase complex, contributing to the coordination of DNA replication machinery, including the DNA polymerase, polymerase clamp, clamp loader complex, primase, DnaB-like SF4 replicative helicase, and the helicase assembly factor. Additionally, T4 gp32 interacts with viral SF1 dDA helicase and viral SF2 UvsW repair helicase, highlighting its central role in orchestrating viral DNA processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
P03695 (M1-L301)
-
Gene ID1258602 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
T4 gp32 (M1-L301)
Accession # P03695 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
gp32, Helix-destabilizing protein; Single-stranded DNA-binding protein; SSB protein; 32; ssb
-
AA Sequence
MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL
-
Predicted Molecular Mass
41.8 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)