1. Recombinant Proteins
  2. Others
  3. TAFA5/FAM19A5 Protein, Human (His)

TAFA5 protein is a member of the TAFA family and is a small secreted protein encoded by a highly homologous gene family. It is distantly related to MIP-1α and is expressed primarily in specific brain regions. TAFA5/FAM19A5 Protein, Human (His) is the recombinant human-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TAFA5 protein is a member of the TAFA family and is a small secreted protein encoded by a highly homologous gene family. It is distantly related to MIP-1α and is expressed primarily in specific brain regions. TAFA5/FAM19A5 Protein, Human (His) is the recombinant human-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.

Background

TAFA5, a member of the TAFA family, is part of a gene family consisting of five highly homologous members that encode small secreted proteins. Characterized by conserved cysteine residues at fixed positions, these proteins share distant relation to MIP-1alpha, a member of the CC-chemokine family. Predominantly expressed in specific regions of the brain, TAFA proteins are postulated to function as brain-specific chemokines or neurokines, potentially serving as regulators of immune and nervous cells. With biased expression observed in brain (RPKM 13.2), endometrium (RPKM 3.4), and various other tissues, TAFA5 emerges as a potential player in the intricate interplay between the immune and nervous systems.

Species

Human

Source

E. coli

Tag

N-8*His

Accession

NP_056196 (T37-S125)

Gene ID
Molecular Construction
N-term
8*His
TAFA5/FAM19A5 (T37-S125)
Accession # NP_056196
C-term
Protein Length

Partial

Synonyms
Chemokine-like protein TAFA-5; Tafa5; Fam19a5; QLLK5208; UNQ5208
AA Sequence

TCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

Molecular Weight

12-14 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TAFA5/FAM19A5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TAFA5/FAM19A5 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAFA5/FAM19A5 Protein, Human (His)
Cat. No.:
HY-P700984
Quantity:
MCE Japan Authorized Agent: