TAFA5/FAM19A5 Protein, Human (His)
Based on 1 Customer Validation
TAFA5 protein is a member of the TAFA family and is a small secreted protein encoded by a highly homologous gene family. It is distantly related to MIP-1α and is expressed primarily in specific brain regions. TAFA5/FAM19A5 Protein, Human (His) is the recombinant human-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TAFA5 protein is a member of the TAFA family and is a small secreted protein encoded by a highly homologous gene family. It is distantly related to MIP-1α and is expressed primarily in specific brain regions. TAFA5/FAM19A5 Protein, Human (His) is the recombinant human-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.
Background
TAFA5, a member of the TAFA family, is part of a gene family consisting of five highly homologous members that encode small secreted proteins. Characterized by conserved cysteine residues at fixed positions, these proteins share distant relation to MIP-1alpha, a member of the CC-chemokine family. Predominantly expressed in specific regions of the brain, TAFA proteins are postulated to function as brain-specific chemokines or neurokines, potentially serving as regulators of immune and nervous cells. With biased expression observed in brain (RPKM 13.2), endometrium (RPKM 3.4), and various other tissues, TAFA5 emerges as a potential player in the intricate interplay between the immune and nervous systems.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
NP_056196 (T37-S125)
-
Molecular Construction
-
N-term
-
8*His
-
TAFA5/FAM19A5 (T37-S125)
Accession # NP_056196 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PRO34524; UNQ5208; FAM19A5; TAFA5; Chemokine-like protein TAFA-5
-
AA Sequence
TCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
-
Predicted Molecular Mass
10.8 kDa
-
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
