TAFA5/FAM19A5 Protein, Human (His)

TAFA5 protein is a member of the TAFA family and is a small secreted protein encoded by a highly homologous gene family. It is distantly related to MIP-1α and is expressed primarily in specific brain regions. TAFA5/FAM19A5 Protein, Human (His) is the recombinant human-derived TAFA5/FAM19A5 protein, expressed by E. coli , with N-His labeled tag.

TAFA5, a member of the TAFA family, is part of a gene family consisting of five highly homologous members that encode small secreted proteins. Characterized by conserved cysteine residues at fixed positions, these proteins share distant relation to MIP-1alpha, a member of the CC-chemokine family. Predominantly expressed in specific regions of the brain, TAFA proteins are postulated to function as brain-specific chemokines or neurokines, potentially serving as regulators of immune and nervous cells. With biased expression observed in brain (RPKM 13.2), endometrium (RPKM 3.4), and various other tissues, TAFA5 emerges as a potential player in the intricate interplay between the immune and nervous systems.

Human

E. coli

N-8*His

NP_056196 (T37-S125)

25817  [NCBI]

Partial

TCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

12-14 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.