TGFBR2/TGF-beta RII Protein, Human (HEK293, His)
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P37173-1 (T23-D159)
-
Gene ID7048
-
Molecular Construction
-
N-term
-
TGFBR2 (T23-D159)
Accession # P37173-1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kin
-
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
