TIGIT Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions. Some member of Ig-like domain-containing protein can bind to membrane Ig signaling receptors and down-regulating T cell activation through competing with Ig proteins for binding, and Ig-like domain-containing protein such as neuregulin proteins can bind to heparin through IgL-like domain, contributing to cardiac and neuronal development[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
G7NXM4/XP_015300911.1 (M89-P209)
-
Gene ID102121588
-
Molecular Construction
-
N-term
-
TIGIT (M89-P209)
Accession # G7NXM4/XP_015300911.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TIGIT; DKFZp667A205; Prev. VSIG9; FLJ39873; Prev. VSTM3; V-Set And Immunoglobulin Domain Containing 9; V-Set And Transmembrane Domain-Containing Protein 3; Washington University Cell Adhesion Molecule; T-Cell Immunoreceptor With Ig And ITIM Domains; V-Set
-
AA Sequence
MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
