Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO)
Based on 1 Customer Validation
Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
Tissue alpha-L-fucosidase, as an enzymatic entity, plays a crucial role in the hydrolysis of alpha-1,6-linked fucose residues attached to the reducing-end N-acetylglucosamine within the carbohydrate moieties of glycoproteins.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q99LJ1 (L18-N452)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
FUCA1 (L18-N452)
Accession # Q99LJ1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FUCA1; Tissue Fucosidase; Alpha-L-Fucosidase 1; A-L-Fucosidase 1; Alpha-L-Fucoside Fucohydrolase 1; I+/--L-Fucosidase 1; Fucosidase, Alpha-L- 1, Tissue; Α-L-Fucosidase 1; Tissue Alpha-L-Fucosidase; FUCA; Alpha-L-Fucosidase I
-
AA Sequence
LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN
-
Predicted Molecular Mass
66.6 kDa
-
Molecular Weight
Approximately 62 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
