1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag)

TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag)

Cat. No.: HY-P78447
Handling Instructions Technical Support

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells. The human TL1A protein has a transmembrane domain (36-56 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag) is the extracullar part of TL1A protein (D91-L251), produced in HEK293 cells with N-terminal His- and Flag-tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
2 μg 해외재고보유
10 μg 해외재고보유
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
250 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis[1][2]. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells[3]. The human TL1A protein has a transmembrane domain (36-56 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag) is the extracullar part of TL1A protein (D91-L251), produced in HEK293 cells with N-terminal His- and Flag-tag.

Background

TL1A (Tumor necrosis factor-like cytokine 1A), also known as TNF ligand-related molecule 1 and vascular endothelial cell growth inhibitor (VEGI), is the receptor for TNFRSF25 and TNFRSF6B, acts as a regulator of mucosal immunity and participates in immunological pathways involved in the inflammatory bowel diseases (IBD) pathogenesis[1]. TL1A belongs to the tumor necrosis factor family, derived from endothelial cell. It is a ligand for DR3 and decoy receptor TR6/DcR3, the interaction with DR3 promotes T cell expansion during an immune response, whereas TR6 has an opposing effect. Moreover, DR3 is the death domain-containing receptor, that is upregulated during T cell activation. TL1A shows an inducible expression by TNF and IL-1alpha, and induces NF-kappaB activation and apoptosis in DR3-expressing cell lines. Meanwhile, TL1A acts as a costimulator that increases IL-2 responsiveness and secretion of proinflammatory cytokines[2]. In addition, TL1A activates c-Jun N-terminal kinase. TL1A also activates caspase-3 leading to PARP cleavage, and inhibits the proliferation of breast carcinoma, epithelial, and myeloid tumor cells. TL1A promotes proliferation of normal human fibroblast cells. These results suggest that VEGI, a new member of the TNF family, has a signaling pathway similar to TNF and is most likely a multifunctional cytokine[3]. Human TL1A protein has two glycosylated domains and one transmembrane domain (36-56 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. The protein sequence of human is much different from mouse and rat with similarities of 68.42% and 70.45%, respectively.

In Vitro

TL1A (100 ng/mL; 15 min) interacts with TR6-Fc, results in NF-κB activation[2].
TL1A (72-251 a.a.; 100 ng/mL; 72 h) increases IL-2 responsiveness and induces cytokine release in anti-CD3- and anti-CD28-treated T cells[2].
TL1A (1 μg/mL; 12-24 h) induces IκB degradation in U-937 cells[3].

In Vivo

TL1A (human, 72-251 a.a.; 3 mg/kg; i.v.; daily for 5 d) enhances in vivo and ex vivo splenic alloactivation in C57BL/6 mice[2].

Biological Activity

1.Immobilized Human TNFSF15 Trimer His at 0.5 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-TNFSF15 Antibody hFc with the EC50 of 10.2-18.7 ng/mL determined by ELISA.
2.Immobilized Human TNFSF15 Trimer, His Tag at 1 μg/mL (100 μl/Well) on the plate. Dose response curve for Anti-TNFSF15 Antibody, hFc Tag with the EC50 of ≤4 ng/mL determined by ELISA.
3.Measured by its binding ability in a functional ELISA. Immobilized Huamn TNFSF15 Trimer at 2 μg/mL (100 μL/Well) can bind Anti-TNFSF15 Antibody. The ED50 for this effect is ≤4 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 Trimer at 1 μg/mL (100 μL/Well) can bind Anti-TNFSF15 Antibody. The ED50 for this effect is 3.112 ng/mL.
Species

Human

Source

HEK293

Tag

N-Flag;N-6*His

Accession

O95150-1 (D91-L251)

Gene ID
Molecular Construction
N-term
6*His-Flag
TL1A (D91-L251)
Accession # O95150-1
C-term
Protein Length

Partial

Synonyms
TL1A; VEGI-251; TNFSF15; TL1; VEGI; VEGI192A
AA Sequence

DGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predicted Molecular Mass
58.2 kDa
분자량

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TL1A/TNFSF15 Trimer Protein, Human (HEK293, His-Flag)
Cat. No.:
HY-P78447
수량:
MCE Japan Authorized Agent: