Copy Link Print Information

TM4SF2/TSPAN7 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TM4SF2/TSPAN7 Protein, Human (HEK293, His)
  • Experimental Validation Results for TM4SF2/TSPAN7 Protein, Human (HEK293, His)
  • TM4SF2/TSPAN7 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Background

Tetraspanin-7 (TSPAN7) is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Notably, this encoded cell surface glycoprotein has been demonstrated to exert a vital role in the control of neurite outgrowth. Overexpression of TSPAN7 activates Bax, cleaves caspase-3 and PTEN, and inhibits BCa cell growth through the PTEN/PI3K/AKT pathway. Low expression of TSPAN7 is associated with response to oxidative stress, regulation of MAPK, cell population of proliferation, response to tumor necrosis factor, regulation of cell migration, negative regulation of programmed cell death and angiogenesis. In addition, TSPAN7 plays an important role in the cytoskeletal organization required for the bone-resorbing function of osteoclasts by regulating signaling to Src, Pyk2, and microtubules[1][2].

Verified Bioactivity

When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED50 for this effect is 111.6 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED50 for this effect is 111.6 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    AAH18036.1 (R113-M213)

  • Gene ID
    7102  [NCBI]
  • Molecular Construction
    • N-term
    • TM4SF2 (R113-M213)
      Accession # AAH18036.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    Mxs1; Tm4sf2; Tetraspanin-7; Tspan-7; Cell surface glycoprotein A15; PE31; TALLA homolog; Transmembrane 4 superfamily member 2; CD antigen; CD231; XLID58; CCG-B7; TM4SF2b; Tetraspanin; Tetraspanin Protein; Transmembrane 4 Superfamily 2b; Transmembrane Pro

  • AA Sequence

    RHEIKDTFLRTYTDTMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

  • Predicted Molecular Mass

    11.6 kDa

  • Molecular Weight

    Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED50 for this effect is 111.6 ng/mL.

  • TM4SF2/TSPAN7 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TM4SF2/TSPAN7 Protein, Human (HEK293, His)
  • Experimental Validation Results for TM4SF2/TSPAN7 Protein, Human (HEK293, His)
  • TM4SF2/TSPAN7 Protein, Human (HEK293, His) Product Image