TPO/Thrombopoietin Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. TPO/Thrombopoietin Protein, Human (HEK293) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. TPO/Thrombopoietin Protein, Human (HEK293) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293, with tag free.

Background

Thrombopoietin (TPO), a lineage-specific cytokine, exerts a pivotal influence on the proliferation and maturation of megakaryocytes, particularly at the late stages of their development from committed progenitor cells. Notably, TPO emerges as a potential major physiological regulator in the intricate orchestration of circulating platelets, underscoring its crucial role in megakaryocyte biology and platelet formation.

Verified Bioactivity

Human Thrombopoietin Protein, premium grade stimulates proliferation of Mo7e cells. The specific activity of Human Thrombopoietin Protein, premium grade is > 1.0×107 IU/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • (S22-G353)
      Accession # P40225-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    THPO; Prepro-Thrombopoietin; Prev. MGDF; MPL Ligand; Myeloproliferative Leukemia Virus Oncogene Ligand; ML; Megakaryocyte Growth And Development Factor; Thrombopoietin Nirs Variant 3; Megakaryocyte Colony-Stimulating Factor; Thrombopoietin Nirs Variant 2;

  • AA Sequence

    SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

  • Predicted Molecular Mass

    35.5 kDa

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of 20 mM NaAc-HAc, pH 5.0 with 11% trehalose as protectant.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00