TROP-2 Protein, Cynomolgus (HEK293, His)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.

The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.

1.Immobilized Cynomolgus TROP-2 at 0.5 μg/ml (100μL/Well). Dose response curve for Anti-TROP-2 Antibody, hFc Tag with the EC₅₀ of 2.8 ng/ml determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Human IGF2R at 1 μg/mL (100μL/well) can bind biotinylated Cynomolgus TROP-2, The ED₅₀ for this effect is 0.1566 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human IGF2R at 1 μg/mL (100 μL/well) can bind biotinylated Cynomolgus TROP-2, The ED₅₀ for this effect is 0.1566 μg/mL.

Cynomolgus

HEK293

C-His

XP_005543292 (H27-T274)

102127436  [NCBI]

Partial

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Approximately 37-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.