TSLP Protein, Cynomolgus (Biotinylated, HEK293, His)
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived TSLP protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c(+) dendritic cells. TSLP Protein, Cynomolgus (Biotinylated, HEK293, His) is the recombinant cynomolgus-derived TSLP protein, expressed by HEK293 , with C-His labeled tag.
Background
The TSLP (thymic stromal lymphopoietin) protein is a cytokine with diverse immunomodulatory functions. It induces the release of T-cell-attracting chemokines from monocytes and promotes the maturation of CD11c(+) dendritic cells, playing a crucial role in the regulation of immune responses. TSLP is known to have implications in allergic inflammation by directly activating mast cells, contributing to the complex network of allergic responses. TSLP exerts its effects by interacting with a receptor complex composed of CRLF2 and IL7R, and the binding of TSLP to CRLF2/TSLPR is a mechanistic prerequisite for recruiting IL7R to form the high-affinity ternary complex. These interactions highlight the intricate molecular mechanisms through which TSLP influences immune cell behavior, emphasizing its role in immune system regulation and allergic responses.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A7N9CAT7 (Y29-Q159)
-
Molecular Construction
-
N-term
-
TSLP (Y29-Q159)
Accession # A0A7N9CAT7 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP
-
AA Sequence
YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
-
Predicted Molecular Mass
16.3 kDa
-
Molecular Weight
Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
