1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TSLP Protein, Human (R127A, R130A, HEK293, His-Avi)

TSLP Protein, Human (R127A, R130A, HEK293, His-Avi)

Cat. No.: HY-P78533
Handling Instructions Technical Support

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (R127A, R130A, HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag and R127A, R130A mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (R127A, R130A, HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag and R127A, R130A mutation.

Background

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q969D9-1 (Y29-Q159, R127A, R130A)

Gene ID
Molecular Construction
N-term
TSLP (Y29-Q159, R127A, R130A)
Accession # Q969D9-1
8*His-Avi
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
thymic stromal lymphopoietin; TSLP
AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Predicted Molecular Mass
17.7 kDa
Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TSLP Protein, Human (R127A, R130A, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TSLP Protein, Human (R127A, R130A, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP Protein, Human (R127A, R130A, HEK293, His-Avi)
Cat. No.:
HY-P78533
Quantity:
MCE Japan Authorized Agent: