TSPO Protein, Human (Cell-Free, His)

The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Human (Cell-Free, His) is the recombinant human-derived TSPO protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Human (Cell-Free, His) is the recombinant human-derived TSPO protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Background

TSPO (Translocator Protein) exhibits the ability to bind protoporphyrin IX, suggesting a potential role in the transport of porphyrins and heme. Initially identified as a peripheral-type benzodiazepine receptor, TSPO can also bind isoquinoline carboxamides. Moreover, it plays a role in promoting cholesterol transport across mitochondrial membranes, implicating its involvement in lipid metabolism. Although its precise physiological function is controversial and some reports suggest that it may not be essential for steroid hormone biosynthesis, TSPO interacts with various proteins such as TSPOAP1, MOST-1, and potentially STAR, indicating its participation in diverse cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • TSPO (2-E169)
      Accession # P30536
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR

  • AA Sequence

    MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

  • Predicted Molecular Mass

    20.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00