TSPO Protein, Human (Cell-Free, His)
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Human (Cell-Free, His) is the recombinant human-derived TSPO protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Human (Cell-Free, His) is the recombinant human-derived TSPO protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Background
TSPO (Translocator Protein) exhibits the ability to bind protoporphyrin IX, suggesting a potential role in the transport of porphyrins and heme. Initially identified as a peripheral-type benzodiazepine receptor, TSPO can also bind isoquinoline carboxamides. Moreover, it plays a role in promoting cholesterol transport across mitochondrial membranes, implicating its involvement in lipid metabolism. Although its precise physiological function is controversial and some reports suggest that it may not be essential for steroid hormone biosynthesis, TSPO interacts with various proteins such as TSPOAP1, MOST-1, and potentially STAR, indicating its participation in diverse cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P30536 (A2-E169)
-
Gene ID706
-
Molecular Construction
-
N-term
-
10*His
-
TSPO (2-E169)
Accession # P30536 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
-
AA Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
-
Predicted Molecular Mass
20.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
