TSST-1 Protein, S. aureus (His-SUMO)
Based on 1 Customer Validation
TSST-1 protein induces symptoms related to toxic shock syndrome. TSST-1 Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived TSST-1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSST-1 protein induces symptoms related to toxic shock syndrome. TSST-1 Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived TSST-1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
The TSST-1 protein is responsible for inducing the symptoms associated with toxic shock syndrome.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P06886 (S41-N234)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
TSST-1 (S41-N234)
Accession # P06886 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
tst; Toxic shock syndrome toxin-1; TSST-1
-
AA Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
-
Predicted Molecular Mass
37.9 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
