TSST-1 Protein, S. aureus (His-SUMO)

TSST-1 protein induces symptoms related to toxic shock syndrome. TSST-1 Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived TSST-1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

The TSST-1 protein is responsible for inducing the symptoms associated with toxic shock syndrome.

Staphylococcus aureus

E. coli

N-SUMO;N-6*His

P06886 (S41-N234)

/

Full Length of Mature Protein

STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.