Tubulin Beta Protein, Human (GST)
Tubulin Beta Protein, Human (GST) is the recombinant human-derived Tubulin Beta, expressed by E. coli , with GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Tubulin Beta Protein, Human (GST) is the recombinant human-derived Tubulin Beta, expressed by E. coli , with GST labeled tag. ,
Background
Beta Tubulin is the major constituent of microtubules, which are cylindrical structures formed by lateral association of linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow through the addition of GTP-tubulin dimers to their ends, forming a stabilizing cap. Below this cap, tubulin dimers exist in a GDP-bound state due to the GTPase activity of alpha-tubulin.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
P07437 (M1-A444)
-
Gene ID203068
-
Protein Length
Full Length
-
Synonyms
TUBB; Tubulin Beta Class I; OK/SW-Cl.56; Tubulin Beta Chain; Tubb5; Tubulin, Beta Polypeptide; M40; Tubulin Beta-5 Chain; MGC16435; Epididymis Secretory Sperm Binding Protein; Tubulin, Beta Class I; Class I Beta-Tubulin; Tubulin Beta-1 Chain; Beta Ib Tubu
-
AA Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
-
Predicted Molecular Mass
76 kDa
-
Molecular Weight
Approximately 76 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
/
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
