Tubulin cofactor A Protein, Human (Tag Free)
Based on 1 Customer Validation
The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.
Background
Tubulin cofactor A Protein takes on a crucial role as a tubulin-folding protein, actively participating in the initial stage of the tubulin folding pathway. It is part of a supercomplex composed of cofactors A to E. Cofactors A and D play a pivotal role by capturing and stabilizing tubulin in a quasi-native conformation. The interaction of cofactor E with the cofactor D-tubulin complex facilitates the subsequent binding to cofactor C, leading to the release of tubulin polypeptides committed to adopting the native state. In orchestrating these intricate steps, Tubulin cofactor A Protein emerges as a key player in the early phases of tubulin folding, contributing to the formation of a functional and stable tubulin structure.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O75347 (M1-A108)
-
Molecular Construction
-
N-term
-
TBCA (M1-A108)
Accession # O75347 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TBCA; CFA; Tubulin Folding Cofactor A; Epididymis Secretory Sperm Binding Protein; Tubulin-Specific Chaperone A; Tubulin-Folding Cofactor A; TCP1-Chaperonin Cofactor A; Chaperonin Cofactor A
-
AA Sequence
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
-
Predicted Molecular Mass
12.9 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
