TXNL4B Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag.

Background

TXNL4B Protein plays an essential role in pre-mRNA splicing, serving as a crucial component required for proper cell cycle progression during the S/G(2) transition. Forming homodimers, TXNL4B interacts with the U5-102 kDa protein subunit of the spliceosome, highlighting its integral involvement in the intricate process of splicing and its impact on cell cycle dynamics.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • TXNL4B (M1-I149)
      Accession # Q9NX01
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    TXNL4B; DIM2; DLP; Thioredoxin-like protein 4B; Dim1-like protein; Thioredoxin Like 4B; Dim2; Alternative Protein TXNL4B; FLJ20511; Dim1-Like Protein; TXNL4B

  • AA Sequence

    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00