TXNL4B Protein, Human (His)
Based on 1 Customer Validation
TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag.
TXNL4B Protein plays an essential role in pre-mRNA splicing, serving as a crucial component required for proper cell cycle progression during the S/G(2) transition. Forming homodimers, TXNL4B interacts with the U5-102 kDa protein subunit of the spliceosome, highlighting its integral involvement in the intricate process of splicing and its impact on cell cycle dynamics.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9NX01 (M1-I149)
-
Gene ID54957 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
TXNL4B (M1-I149)
Accession # Q9NX01 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TXNL4B; DIM2; DLP; Thioredoxin-like protein 4B; Dim1-like protein; Thioredoxin Like 4B; Dim2; Alternative Protein TXNL4B; FLJ20511; Dim1-Like Protein; TXNL4B
-
AA Sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
