1. Recombinant Proteins
  2. Others
  3. TXNL4B Protein, Human (His)

TXNL4B Protein, Human (His)

Cat. No.: HY-P77270
COA Handling Instructions

TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag. The total length of TXNL4B Protein, Human (His) is 149 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G(2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag. The total length of TXNL4B Protein, Human (His) is 149 a.a., with molecular weight of ~19 kDa.

Background

TXNL4B Protein plays an essential role in pre-mRNA splicing, serving as a crucial component required for proper cell cycle progression during the S/G(2) transition. Forming homodimers, TXNL4B interacts with the U5-102 kDa protein subunit of the spliceosome, highlighting its integral involvement in the intricate process of splicing and its impact on cell cycle dynamics.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9NX01 (M1-I149)

Gene ID

54957  [NCBI]

Molecular Construction
N-term
His
TXNL4B (M1-I149)
Accession # Q9NX01
C-term
Synonyms
Thioredoxin-like protein 4B; Dim1-like protein; DIM2; DLP
AA Sequence

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 20% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TXNL4B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNL4B Protein, Human (His)
Cat. No.:
HY-P77270
Quantity:
MCE Japan Authorized Agent: