U2AF2 Protein, Human (His, Strep)
U2AF2 Protein, Human (His, Strep) is the recombinant human-derived U2AF2, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
U2AF2 Protein, Human (His, Strep) is the recombinant human-derived U2AF2, expressed by E. coli , with Strep, His labeled tag. ,
U2AF2 plays a role in pre-mRNA splicing and 3'-end processing. By recruiting PRPF19 and the PRP19C/Prp19 complex/NTC/Nineteen complex to the RNA polymerase II C-terminal domain (CTD) and binding to pre-mRNA, it may couple transcription with splicing. In muscle tissue, it induces cardiac troponin-T (TNNT2) pre-mRNA exon inclusion and regulates TNNT2 exon 5 inclusion through competition with MBNL1. During spliceosome assembly, it preferentially binds to a single-stranded structure within the polypyrimidine tract of TNNT2 intron 4. It is also required for mRNA nuclear export, even for intron-less genes. Additionally, it represses the splicing of MAPT/Tau exon 10 and positively regulates pre-mRNA 3'-end processing by recruiting the CFIm complex to cleavage and polyadenylation signals.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P26368-1 (V140-A342 )
-
Gene ID11338
-
Protein Length
Partial
-
Synonyms
U2AF2; U2AF65; U2 SnRNP Auxiliary Factor Large Subunit; U2 Small Nuclear RNA Auxiliary Factor 2; Splicing factor U2AF 65 kDa subunit; U2 auxiliary factor 65 kDa subunit; hU2AF65; hU2AF65; U2 snRNP auxiliary factor large subunit; DEVDFB; HU2AF(65); Splicin
-
AA Sequence
VGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
-
Predicted Molecular Mass
25.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
