UBE2F Protein, Human (His, Solution)

The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2F Protein, Human (His, Solution) is the recombinant human-derived UBE2F, expressed by E. coli, with N-6*His labeled tag.

UBE2F protein plays a crucial role in the ubiquitin-like protein NEDD8 conjugation pathway, accepting NEDD8 from the UBA3-NAE1 E1 complex and catalyzing its covalent attachment to various target proteins. Its distinctive interaction with the E3 ubiquitin ligase RBX2, rather than RBX1, implies that the RBX2-UBE2F complex is specialized in neddylating specific target proteins, notably CUL5. This specific interaction and neddylating activity highlight UBE2F's involvement in the regulation of cellular processes related to the targeted ubiquitination of key substrates.

Measured in a cell proliferation assay using A427 cells. The ED₅₀ for this effect is 1.04 ng/mL, corresponding to a specific activity is 9.615×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using A427 cells. The ED₅₀ for this effect is 1.04 ng/mL , corresponding to a specific activity is 9.615×10⁵ units/mg.

Human

E. coli

N-6*His

Q969M7-1 (M1-R185)

140739

Full Length of Isoform-1

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 2 mM DTT, 10% glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.