UBE2F Protein, Human (His, Solution)
Based on 1 Customer Validation
The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2F Protein, Human (His, Solution) is the recombinant human-derived UBE2F, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2F Protein, Human (His, Solution) is the recombinant human-derived UBE2F, expressed by E. coli, with N-6*His labeled tag.
UBE2F protein plays a crucial role in the ubiquitin-like protein NEDD8 conjugation pathway, accepting NEDD8 from the UBA3-NAE1 E1 complex and catalyzing its covalent attachment to various target proteins. Its distinctive interaction with the E3 ubiquitin ligase RBX2, rather than RBX1, implies that the RBX2-UBE2F complex is specialized in neddylating specific target proteins, notably CUL5. This specific interaction and neddylating activity highlight UBE2F's involvement in the regulation of cellular processes related to the targeted ubiquitination of key substrates.
Measured in a cell proliferation assay using A427 cells. The ED50 for this effect is 1.04 ng/mL, corresponding to a specific activity is 9.615×105 units/mg.
-
Measured in a cell proliferation assay using A427 cells. The ED50 for this effect is 1.04 ng/mL , corresponding to a specific activity is 9.615×105 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q969M7-1 (M1-R185)
-
Gene ID140739
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NEDD8-conjugating enzyme UBE2F; NCE2
-
AA Sequence
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 2 mM DTT, 10% glycerol.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
