UCK2 Protein, Human (His, Strep)
UCK2 Protein, Human (His, Strep) is the recombinant human-derived UCK2, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
UCK2 Protein, Human (His, Strep) is the recombinant human-derived UCK2, expressed by E. coli , with Strep, His labeled tag. ,
UCK2 is a kinase that phosphorylates uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. It does not phosphorylate deoxyribonucleosides or purine ribonucleosides but can use either ATP or GTP as a phosphate donor. Additionally, UCK2 can phosphorylate various cytidine and uridine nucleoside analogs, including 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q9BZX2-1 (M1-H261)
-
Gene ID7371
-
Protein Length
Full Length of Isoform-1
-
Synonyms
UCK2; Uridine‑Cytidine Kinase 2; UMPK; Testis‑Specific Protein TSA903; Uridine Monophosphate Kinase; Cytidine Monophosphokinase 2; Uridine Monophosphokinase 2; Uridine/Cytidine Kinase; Uridine Kinase; TSA903; UCK 2; UK
-
AA Sequence
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
-
Predicted Molecular Mass
32.5 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
