UE2NL Protein, Human (sf9, His, StrepⅡ)

The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9, His, Strep) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

UE2NL protein is specifically expressed in the epididymis at the protein level, indicating its potential role in the regulation of molecular processes within this reproductive tissue. As a member of the ubiquitin-conjugating enzyme family, UE2NL is likely involved in ubiquitin-mediated signaling pathways, potentially contributing to the post-translational modification of proteins in the epididymal microenvironment. The tissue-specific expression emphasizes the significance of UE2NL in epididymal function, underscoring its potential involvement in molecular events related to reproductive processes or sperm maturation within the epididymis.

Human

Sf9 insect cells

N-StrepⅡ;N-8*His

Q5JXB2 (A2-I153)

389898

Partial

AELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAMNSI

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.