UE2NL Protein, Human (sf9, His, StrepⅡ)

The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9, His, Strep) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9, His, Strep) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UE2NL protein is specifically expressed in the epididymis at the protein level, indicating its potential role in the regulation of molecular processes within this reproductive tissue. As a member of the ubiquitin-conjugating enzyme family, UE2NL is likely involved in ubiquitin-mediated signaling pathways, potentially contributing to the post-translational modification of proteins in the epididymal microenvironment. The tissue-specific expression emphasizes the significance of UE2NL in epididymal function, underscoring its potential involvement in molecular events related to reproductive processes or sperm maturation within the epididymis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-StrepⅡ;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His-StrepⅡ
    • UE2NL (A2-I153)
      Accession # Q5JXB2
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2NL; Ubiquitin Conjugating Enzyme E2 N Like (Gene/Pseudogene); Putative Ubiquitin-Conjugating Enzyme E2 N-Like; Epididymis Tissue Protein Li 174; Ubiquitin-Conjugating Enzyme E2N-Like (Gene/Pseudogene); Ubiquitin-Conjugating Enzyme E2N-Like; Ubiquitin

  • AA Sequence

    AELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAMNSI

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00