UE2NL Protein, Human (sf9, His, StrepⅡ)
The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9, His, Strep) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The UE2NL protein is expressed exclusively in the epididymis and regulates molecular processes in this reproductive tissue. As part of a family of ubiquitin-conjugating enzymes, UE2NL may be involved in ubiquitin-mediated signaling pathways affecting post-translational protein modifications in the epididymal microenvironment. UE2NL Protein, Human (sf9, His, Strep) is the recombinant human-derived UE2NL protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
UE2NL protein is specifically expressed in the epididymis at the protein level, indicating its potential role in the regulation of molecular processes within this reproductive tissue. As a member of the ubiquitin-conjugating enzyme family, UE2NL is likely involved in ubiquitin-mediated signaling pathways, potentially contributing to the post-translational modification of proteins in the epididymal microenvironment. The tissue-specific expression emphasizes the significance of UE2NL in epididymal function, underscoring its potential involvement in molecular events related to reproductive processes or sperm maturation within the epididymis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q5JXB2 (A2-I153)
-
Gene ID389898
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UE2NL (A2-I153)
Accession # Q5JXB2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2NL; Ubiquitin Conjugating Enzyme E2 N Like (Gene/Pseudogene); Putative Ubiquitin-Conjugating Enzyme E2 N-Like; Epididymis Tissue Protein Li 174; Ubiquitin-Conjugating Enzyme E2N-Like (Gene/Pseudogene); Ubiquitin-Conjugating Enzyme E2N-Like; Ubiquitin
-
AA Sequence
AELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAMNSI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
