UEVLD Protein, Human (sf9)

UEVLD proteins are considered potential negative regulators of polyubiquitination, possibly controlling the ubiquitin-proteasome system. Its ability to form homodimers suggests that it has self-interacting properties, which may contribute to its role in regulating polyubiquitin chains. UEVLD Protein, Human (sf9) is the recombinant human-derived UEVLD protein, expressed by sf9 insect cells , with tag free.

UEVLD protein is suggested to function as a potential negative regulator of polyubiquitination, possibly exerting regulatory control over the ubiquitin-proteasome system. The protein is known to form homodimers, indicating a self-interacting nature that may contribute to its functional role in modulating polyubiquitin chains. The specifics of its regulatory mechanism and the range of proteins or processes it may influence warrant further investigation, but its homodimeric nature suggests a potential involvement in the intricate network of cellular ubiquitination pathways.

Human

Sf9 insect cells

Tag Free

Q8IX04 (E2-L471)

55293

Partial

EFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.