1. Recombinant Proteins
  2. Others
  3. ULBP-6/RAET1L Protein, Human (HEK293, His)

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, His) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, His) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293 , with C-His labeled tag.

Background

NKG2DL2, a key participant in immune response modulation, exerts its influence by binding to and activating the KLRK1/NKG2D receptor. This interaction serves as a pivotal trigger for natural killer (NK) cell cytotoxicity, a fundamental aspect of the immune system's defense against various threats. NKG2DL2's ability to engage with KLRK1/NKG2D underscores its role in orchestrating NK cell responses. Notably, it does not form a binding association with beta2-microglobulin, further elucidating the specificity of its molecular interactions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human NKG2D/CD314 is immobilized at 1 μg/mL (100 μL/well) can bind Human ULBP-6/RAET1L. The ED50 for this effect is 27.800 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q5VY80 (R26-S217)

Gene ID

154064  [NCBI]

Molecular Construction
N-term
ULBP6 (R26-S217)
Accession # Q5VY80
His
C-term
Protein Length

Partial

Synonyms
UL16-binding protein 6; Retinoic acid early transcript 1L protein; ULBP6; RAET1L
AA Sequence

RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

분자량

Approximately 27-33 kDa due to the glycosylation

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

ULBP-6/RAET1L Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ULBP-6/RAET1L Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ULBP-6/RAET1L Protein, Human (HEK293, His)
Cat. No.:
HY-P77503
수량:
MCE Japan Authorized Agent: