Copy Link Print Information

uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived uPAR protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.

Verified Bioactivity

Human PLAU, His Tag immobilized on CM5 Chip can bind Biotinylated Mouse uPAR, His Tag with an affinity constant of 418.50 nM as determined in SPR assay (Biacore T200).

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    P35456-1 (L24-G298)

  • Gene ID
    18793  [NCBI]
  • Molecular Construction
    • N-term
    • uPAR (L24-G298)
      Accession # P35456-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Full Length of Partial Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;

  • AA Sequence

    LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTG

  • Predicted Molecular Mass

    32.9 kDa

  • Molecular Weight

    Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • uPAR Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image