uPAR Protein, Mouse (HEK293, Fc)

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR, Mouse (HEK293, Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR, Mouse (HEK293, Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293, with C-His labeled tag.

Background

The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • uPAR (L24-P296)
      Accession # P35456-1
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;

  • AA Sequence

    LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSP

  • Predicted Molecular Mass

    56.3 kDa

  • Molecular Weight

    Approximately 80-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00