uPAR Protein, Mouse (HEK293, Fc)
The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR, Mouse (HEK293, Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The uPAR protein acts as a receptor for urokinase plasminogen activator, facilitating plasmin formation and signal transduction activation. It interacts with SRPX2 and forms a monomer. uPAR also interacts with MRC2 and SORL1, reducing PLAUR internalization. Additionally, the PLAUR-PLAU-SERPINE1 complex interacts with SORL1. uPAR, Mouse (HEK293, Fc) is the recombinant mouse-derived uPAR protein, expressed by HEK293, with C-His labeled tag.
Background
The uPAR protein functions as a receptor for urokinase plasminogen activator and plays a crucial role in localizing and facilitating the formation of plasmin. Additionally, it mediates signal transduction activation effects of U-PA independently of proteolysis. It is predominantly found as a monomer and interacts with SRPX2 through its UPAR/Ly6 domains. uPAR also interacts with MRC2 and SORL1, with the latter interaction reducing PLAUR internalization. Moreover, the ternary complex consisting of PLAUR-PLAU-SERPINE1 also interacts with SORL1.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P35456-1 (L24-P296)
-
Gene ID18793
-
Molecular Construction
-
N-term
-
uPAR (L24-P296)
Accession # P35456-1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;
-
AA Sequence
LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSP
-
Predicted Molecular Mass
56.3 kDa
-
Molecular Weight
Approximately 80-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)