USP30 Protein, Human (sf9)
Based on 1 publication(s) in Google Scholar
USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
USP30 protein is anchored on the outer mitochondrial membrane and severely inhibits mitophagy by antagonizing Parkin (PRKN). Hydrolyzing ubiquitin on RHOT1/MIRO1 and target proteins such as TOMM20 and USP30 blocks Parkin-mediated mitophagy, thereby regulating the clearance of damaged mitochondria. USP30 Protein, Human (sf9) is the recombinant human-derived USP30 protein, expressed by sf9 insect cells , with tag free.
Background
USP30 Protein, anchored to the mitochondrial outer membrane, assumes a critical role as a deubiquitinating enzyme that acts as a key inhibitor of mitophagy, countering the actions of parkin (PRKN). By hydrolyzing ubiquitin attached by parkin on target proteins such as RHOT1/MIRO1 and TOMM20, USP30 impedes parkin's ability to drive mitophagy, thereby regulating the selective clearance of damaged mitochondria. Its substrate specificity extends to the preferential cleavage of 'Lys-6'- and 'Lys-11'-linked polyubiquitin chains, key linkages involved in mitophagic signaling. Notably, USP30 does not efficiently cleave polyubiquitin phosphorylated at 'Ser-65'. Beyond its role in mitophagy, USP30 also functions as a negative regulator of mitochondrial fusion, mediating the deubiquitination of MFN1 and MFN2. This dual role underscores the intricate regulatory mechanisms by which USP30 orchestrates mitochondrial dynamics and quality control, playing a central role in maintaining mitochondrial homeostasis.
Verified Bioactivity
The fundamental role of USP30 is specific removal of ubiquitin from substrates. USP30 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535 nM emission light under the excitation condition of 485 nM. The signal of which can be quickly and reliably captured using a microplate reader.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Eur J Med Chem
Discovery of a selenium-containing compound as a promising ferroptosis inducer attenuates prostate cancer progression. [Abstract]2025 Dec 5:299:118067. PMID: 40834498
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q70CQ3 (T57-E517)
-
Gene ID84749
-
Molecular Construction
-
N-term
-
USP30 (T57-E517)
Accession # Q70CQ3 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
USP30; Ubiquitin Specific Peptidase 30; Ubiquitin-Specific-Processing Protease 30; Ubiquitin Carboxyl-Terminal Hydrolase 30; Deubiquitinating Enzyme 30; Ubiquitin Thioesterase 30; Ub-Specific Protease 30; MGC10702; FLJ40511; Ubiquitin Carboxyl-Terminal Hy
-
AA Sequence
TERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE
-
Predicted Molecular Mass
52.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)