USP50 Protein, Human (sf9)
USP50 protein, also known as ubiquitin-specific protease 50, is a protein without peptidase activity. Peptidase activity generally refers to the ability of an enzyme to cleave peptide bonds in proteins. USP50 Protein, Human (sf9) is the recombinant human-derived USP50 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
USP50 protein, also known as ubiquitin-specific protease 50, is a protein without peptidase activity. Peptidase activity generally refers to the ability of an enzyme to cleave peptide bonds in proteins. USP50 Protein, Human (sf9) is the recombinant human-derived USP50 protein, expressed by sf9 insect cells , with tag free.
Background
USP50 protein, also known as ubiquitin-specific protease 50, is a protein that does not possess peptidase activity. Peptidase activity typically refers to the ability of an enzyme to cleave peptide bonds in proteins. However, USP50 protein lacks this particular enzymatic activity. While the function of USP50 protein is still not fully understood, its lack of peptidase activity suggests that it may have other roles or functions within the cell that do not involve direct peptide bond cleavage. Further research is needed to uncover the exact role and significance of USP50 protein in cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q70EL3 (T2-A339)
-
Gene ID373509
-
Molecular Construction
-
N-term
-
USP50 (T2-A339)
Accession # Q70EL3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
USP50; Ubiquitin Specific Peptidase 50; Ubiquitin Carboxyl-Terminal Hydrolase 50; Ubiquitin Specific Protease 50; Inactive Ubiquitin Carboxyl-Terminal Hydrolase 50; Inactive Ubiquitin-Specific Peptidase 50; Ubiquitin-Specific Peptidase 50; Alternative Pro
-
AA Sequence
TSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)