VEGF-A Protein, Rabbit (His-SUMO)

Customer Review

Based on 1 Customer Validation

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived VEGF-A protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived VEGF-A protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The VEGF-A Protein, a versatile growth factor, plays a crucial role in angiogenesis, vasculogenesis, and endothelial cell growth. Its diverse effects include inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis, and inducing permeabilization of blood vessels. VEGF-A achieves these functions by binding to receptors FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. Notably, its interaction with the NRP1 receptor initiates a signaling pathway essential for motor neuron axon guidance and cell body migration during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor, further expanding its regulatory roles. Structurally, VEGF-A exists as a homodimer linked by disulfide bonds and can also form heterodimers with PGF. Interactions with NRP1 and BSG underscore the intricate molecular relationships that underlie the multifaceted functions of VEGF-A in orchestrating vascular processes and embryonic development.

Technical Parameters

  • Species Rabbit
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • VEGF-A (Y51-R511, X303W)
      Accession # XP_002714743.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

  • Predicted Molecular Mass

    65.7 kDa

  • Molecular Weight

    Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00