VEGF-A Protein, Rabbit (P. pastoris, His)
Based on 1 Customer Validation
The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived VEGF-A protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Rabbit
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived VEGF-A protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
The VEGF-A Protein, a versatile growth factor, plays a crucial role in angiogenesis, vasculogenesis, and endothelial cell growth. Its diverse effects include inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis, and inducing permeabilization of blood vessels. VEGF-A achieves these functions by binding to receptors FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. Notably, its interaction with the NRP1 receptor initiates a signaling pathway essential for motor neuron axon guidance and cell body migration during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor, further expanding its regulatory roles. Structurally, VEGF-A exists as a homodimer linked by disulfide bonds and can also form heterodimers with PGF. Interactions with NRP1 and BSG underscore the intricate molecular relationships that underlie the multifaceted functions of VEGF-A in orchestrating vascular processes and embryonic development.
Technical Parameters
-
Species Rabbit
-
Source P. pastoris
-
Tag N-6*His
-
Accession
XP_002714743.1 (Y51-R511, X303W)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
VEGF-A (Y51-R511, X303W)
Accession # XP_002714743.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR
-
Predicted Molecular Mass
51.7 kDa
-
Molecular Weight
Approximately 45-66 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)