1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGFs & VEGFRs
  4. VEGFs
  5. VEGF121 Protein, Human (205a.a)

VEGF121 Protein, Human (205a.a)

Cat. No.: HY-P7420
Handling Instructions

VEGF121 Protein, Human (205a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $540 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE VEGF121 Protein, Human (205a.a)

VEGF121 Protein, Human (205a.a) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P15692 (P28-R232)

Gene ID

7422

Synonyms
rHuVEGF-121; VEGF-A; VPF
AA Sequence

MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Weight

Approximately 28.2 kDa

Biological Activity
The ED50 is <5 ng/mL as measured by HUVEC cells, corresponding to a specific activity of >2 × 105/sup> units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

VEGF-121 lacks heparin binding ability and requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells[1]. In addition, VEGF-121 and VEGF 165 regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. VEGF-121 is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers[2][3]. Furthermore, VEGF-121 plasma level is biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma[4].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF121 Protein, Human (205a.a)
Cat. No.:
HY-P7420
Quantity:
MCE Japan Authorized Agent: