Copy Link Print Information

VEGF121 Protein, Human (120 a.a)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • VEGF121 Protein, Human (120 a.a) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

Background

VEGF-121 lacks heparin binding ability and requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells[1]. In addition, VEGF-121 and VEGF 165 regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. VEGF-121 is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers[2][3]. Furthermore, VEGF-121 plasma level is biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma[4].

Verified Bioactivity

1. The ED50 is ≤7.548 ng/mL as measured by HUVEC cells, corresponding to a specific activity of ≥1.32 × 105 units/mg.
2. Immobilized Human VEGF 121 at 2 μg/mL (100 μl/well) can bind Human VEGFR2-Fc.The ED50 of Human VEGFR2-Fc is ≤78 ng/mL.
3. Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind VEGF121 Protein, Human (120 a.a) with an affinity constant of <1.000E-11 M as determined in BLI assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 7.474 ng/mL, corresponding to a specific activity is 1.34×105 units/mg.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind VEGF121 Protein, Human (120 a.a) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P15692-9 (P28-R147)

  • Gene ID
    7422  [NCBI]
  • Molecular Construction
    • N-term
    • VEGF121 (P28-R147)
      Accession # P15692-9
    • C-term
  • Protein Length

    Full Length of Isoform-9

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

  • Predicted Molecular Mass

    14 kDa

  • Molecular Weight

    Approximately 16 kDa under reduced (R) conditions, 28 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cohen T, et al. VEGF121, a vascular endothelial growth factor (VEGF) isoform lacking heparin binding ability, requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells. J Biol Chem. 1995 May 12;270(19):11322-6. [Content Brief]

[2]. Broséus J, et al. VEGF121, is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers. Oncotarget. 2017 Jul 19;8(53):90808-90824. [Content Brief]

[3]. Nakatsu MN, et al. VEGF(121) and VEGF(165) regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. Lab Invest. 2003 Dec;83(12):1873-85. [Content Brief]

[4]. Martini M, et al. VEGF-121 plasma level as biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma. BMC Cancer. 2018 May 10;18(1):553. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 7.474 ng/mL, corresponding to a specific activity is 1.34×105 units/mg.

  • 1/16

    MedChemExpress Validation
     Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind VEGF121 Protein, Human (120 a.a) with an affinity constant of <1.000E-11 M as determined in BLI assay.

  • 1/16

    VEGF121 Protein, Human (120 a.a) purchased from MedChemExpress. Usage Cited in: Int J Mol Sci. 2024 May 20;25(10):5559. [Abstract]

    Customer Validation
     The conditioned media from RT4 (n=7) and T24 (n=11) cells transfected with siPSMB4 were collected. The angiogenesis factors of VEFG-121, VEGF-165, and VEGF-B (2 µg/mL) were added into the condition media. Tube formation was observed after 6 h.

  • VEGF121 Protein, Human (120 a.a) Product Image
    1/16
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • Experimental Validation Results for VEGF121 Protein, Human (120 a.a)
  • VEGF121 Protein, Human (120 a.a) Product Image

  • VEGF121 Protein, Human (120 a.a) purchased from MedChemExpress. Usage Cited in: Int J Mol Sci. 2024 May 20;25(10):5559. [Abstract]

    The conditioned media from RT4 (n=7) and T24 (n=11) cells transfected with siPSMB4 were collected. The angiogenesis factors of VEFG-121, VEGF-165, and VEGF-B (2 µg/mL) were added into the condition media. Tube formation was observed after 6 h.