Versican Isoform V0 Protein, Human (His, B2M, Myc)

Versican Isoform V0 is an isotype of versican with its central domain of containing both the GAG-α and GAG-β domains. Versican Isoform V0 protein can be used in research on inflammatory diseases and cancer. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag^[1][2].

Versican is a large chondroitin sulfate proteoglycan belonging to the lectican family. Versican is a variably glycanated, hyaluronan-binding, chondroitin sulfate-containing molecule that likely serves an anti-adhesion function and regulates the hydration properties of pericellular matrices. The central domain of Versican is decorated with glycosaminoglycans. Alternative splicing of versican generates at least five isoforms named V0, V1, V2, V3 and V4. The central domain of Versican Isoform V0 contains both the GAG-α and GAG-β domains. Versican Isoform V0 is upregulated in tumor cells and can regulate tumor cell proliferation and migration. Versican Isoform V0 act, possibly in concert with other inhibitory molecules such as aggrecan and ephrins, in directing the migratory streams of neural crest cells to their appropriate target tissues. Versican Isoform V0 protein can be used in research on inflammatory diseases and cancer^[1][2].

Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

• 
  Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

Human

E. coli

N-B2M;C-Myc;N-10*His

P13611-1 (G3089-N3354)

1462

Partial

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kischel P, et al. Versican overexpression in human breast cancer lesions: known and new isoforms for stromal tumor targeting. Int J Cancer. 2010 Feb 1;126(3):640-50.

  [2]. Elhashani S, et al. Expression of versican isoforms V0/V1 by pancreatic cancer associated fibroblasts increases fibroblast proliferation. Pancreatology. 2024 Aug;24(5):719-731.