Copy Link Print Information

Versican Isoform V0 Protein, Human (His, B2M, Myc)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Versican Isoform V0 is an isotype of versican with its central domain of containing both the GAG-α and GAG-β domains. Versican Isoform V0 protein can be used in research on inflammatory diseases and cancer. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Versican Isoform V0 Protein, Human (His, B2M, Myc)
  • Experimental Validation Results for Versican Isoform V0 Protein, Human (His, B2M, Myc)
  • Versican Isoform V0 Protein, Human (His, B2M, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Versican Isoform V0 is an isotype of versican with its central domain of containing both the GAG-α and GAG-β domains. Versican Isoform V0 protein can be used in research on inflammatory diseases and cancer. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli, with N-B2M, C-Myc, N-10*His labeled tag[1][2].

Background

Versican is a large chondroitin sulfate proteoglycan belonging to the lectican family. Versican is a variably glycanated, hyaluronan-binding, chondroitin sulfate-containing molecule that likely serves an anti-adhesion function and regulates the hydration properties of pericellular matrices. The central domain of Versican is decorated with glycosaminoglycans. Alternative splicing of versican generates at least five isoforms named V0, V1, V2, V3 and V4. The central domain of Versican Isoform V0 contains both the GAG-α and GAG-β domains. Versican Isoform V0 is upregulated in tumor cells and can regulate tumor cell proliferation and migration. Versican Isoform V0 act, possibly in concert with other inhibitory molecules such as aggrecan and ephrins, in directing the migratory streams of neural crest cells to their appropriate target tissues. Versican Isoform V0 protein can be used in research on inflammatory diseases and cancer[1][2].

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-B2M;C-Myc;N-10*His
  • Accession

    P13611-1 (G3089-N3354)

  • Gene ID
    1462
  • Molecular Construction
    • N-term
    • 10*His-B2M
    • VCAN (G3089-N3354)
      Accession # P13611-1
    • Myc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VCAN; Versican; CSPG2; PG-M; Chondroitin Sulfate Proteoglycan Core Protein 2; Large Fibroblast Proteoglycan; Versican Core Protein; Chondroitin Sulfate Proteoglycan 2; Glial Hyaluronate-Binding Protein; Versican Proteoglycan; GHAP; VCAN Protein; ERVR; WGN

  • AA Sequence

    GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

  • Predicted Molecular Mass

    43.5 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Kischel P, et al. Versican overexpression in human breast cancer lesions: known and new isoforms for stromal tumor targeting. Int J Cancer. 2010 Feb 1;126(3):640-50. [Content Brief]

[2]. Elhashani S, et al. Expression of versican isoforms V0/V1 by pancreatic cancer associated fibroblasts increases fibroblast proliferation. Pancreatology. 2024 Aug;24(5):719-731. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

  • Versican Isoform V0 Protein, Human (His, B2M, Myc) Product Image
    1/16
  • Experimental Validation Results for Versican Isoform V0 Protein, Human (His, B2M, Myc)
  • Experimental Validation Results for Versican Isoform V0 Protein, Human (His, B2M, Myc)
  • Versican Isoform V0 Protein, Human (His, B2M, Myc) Product Image