1. Recombinant Proteins
  2. Others
  3. Vibrio cholerae serotype O1 CTXB Protein (HEK293, His)

Vibrio cholerae serotype O1 CTXB Protein (HEK293, His)

Cat. No.: HY-P704223
Handling Instructions Technical Support

The pentameric ring of the B subunit of the CTXB protein guides the A subunit by binding to GM1 ganglioside on intestinal epithelial cells. This loop binds five GM1 gangliosides and promotes the specific interaction of the toxin with its cellular receptor. Vibrio cholerae serotype O1 CTXB Protein (HEK293, His) is the recombinant virus-derived Vibrio cholerae serotype O1 CTXB protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The pentameric ring of the B subunit of the CTXB protein guides the A subunit by binding to GM1 ganglioside on intestinal epithelial cells. This loop binds five GM1 gangliosides and promotes the specific interaction of the toxin with its cellular receptor. Vibrio cholerae serotype O1 CTXB Protein (HEK293, His) is the recombinant virus-derived Vibrio cholerae serotype O1 CTXB protein, expressed by HEK293, with C-His labeled tag.

Background

The CTXB protein, represented by its B subunit pentameric ring, plays a pivotal role in guiding the A subunit to its target by binding to GM1 gangliosides on the surface of intestinal epithelial cells. The pentameric ring is adept at binding five GM1 gangliosides, facilitating the specific interaction between the toxin and its cellular receptor. Notably, the CTXB B subunit lacks toxic activity on its own. The holotoxin, known as choleragen, comprises a pentameric ring of B subunits, forming a structure with a central pore occupied by the A subunit. The A subunit itself consists of two chains, A1 and A2, connected by a disulfide bridge, further emphasizing the intricate architecture and functionality of this toxin.

Species

Virus

Source

HEK293

Tag

C-His

Accession

P01556 (T22-N124)

Gene ID

/

Molecular Construction
N-term
ctxB (T22-N124)
Accession # P01556
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cholera enterotoxin subunit B/CTxB (Vibrio cholerae); L(strain ATCC 39315 / El Tor Inaba N16961
AA Sequence

TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Predicted Molecular Mass
13.5 kDa
Molecular Weight

Approximately 16-17 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Structure/Form
Pentamer
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Vibrio cholerae serotype O1 CTXB Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Vibrio cholerae serotype O1 CTXB Protein (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vibrio cholerae serotype O1 CTXB Protein (HEK293, His)
Cat. No.:
HY-P704223
Quantity:
MCE Japan Authorized Agent: