Vibrio cholerae serotype O1 CTXB Protein (HEK293, His)
The pentameric ring of the B subunit of the CTXB protein guides the A subunit by binding to GM1 ganglioside on intestinal epithelial cells. This loop binds five GM1 gangliosides and promotes the specific interaction of the toxin with its cellular receptor. Vibrio cholerae serotype O1 CTXB Protein (HEK293, His) is the recombinant virus-derived Vibrio cholerae serotype O1 CTXB protein, expressed by HEK293, with C-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The pentameric ring of the B subunit of the CTXB protein guides the A subunit by binding to GM1 ganglioside on intestinal epithelial cells. This loop binds five GM1 gangliosides and promotes the specific interaction of the toxin with its cellular receptor. Vibrio cholerae serotype O1 CTXB Protein (HEK293, His) is the recombinant virus-derived Vibrio cholerae serotype O1 CTXB protein, expressed by HEK293, with C-His labeled tag.
Background
The CTXB protein, represented by its B subunit pentameric ring, plays a pivotal role in guiding the A subunit to its target by binding to GM1 gangliosides on the surface of intestinal epithelial cells. The pentameric ring is adept at binding five GM1 gangliosides, facilitating the specific interaction between the toxin and its cellular receptor. Notably, the CTXB B subunit lacks toxic activity on its own. The holotoxin, known as choleragen, comprises a pentameric ring of B subunits, forming a structure with a central pore occupied by the A subunit. The A subunit itself consists of two chains, A1 and A2, connected by a disulfide bridge, further emphasizing the intricate architecture and functionality of this toxin.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-His
-
Accession
P01556 (T22-N124)
-
Gene ID/
-
Molecular Construction
-
N-term
-
ctxB (T22-N124)
Accession # P01556 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VC_1456; toxB; ctxB; Choleragenoid; Cholera enterotoxin gamma chain; Cholera enterotoxin B chain; Cholera enterotoxin subunit B
-
AA Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Pentamer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
