VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi)
V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 242 a.a., with molecular weight of 60-66 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 242 a.a., with molecular weight of 60-66 kDa.
Background
V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines (IL-2, IFN-γ, IL-17, IL-6, and IL-19), chemokines (MCP-1, MCP-10, and IP-10) and other proteins (IGFBP3 and RBP4) on anti-CD3 activated human CD3 T cells. VSIG-8 significantly reduces the production of IFN-γand IL-2 on both CD4 and CD8 T cells in the presence of T-cell receptor signaling. VSIG-8 markedly suppresses anti-CD3-induced human T cell proliferation and profoundly decreases the conversion of naïve CD4+ T cells into Th1 cells[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
P0DPA2 (V22-G263)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
VSIG8; V-Set And Immunoglobulin Domain Containing 8; V-Set And Immunoglobulin Domain-Containing Protein 8; C1orf204
-
AA Sequence
VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
-
Predicted Molecular Mass
55.5 kDa
-
Molecular Weight
Approximately 60-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)