1. Recombinant Proteins
  2. Biotinylated Proteins
  3. VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi)

VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78787
Handling Instructions Technical Support

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 242 a.a., with molecular weight of 60-66 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 242 a.a., with molecular weight of 60-66 kDa.

Background

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines (IL-2, IFN-γ, IL-17, IL-6, and IL-19), chemokines (MCP-1, MCP-10, and IP-10) and other proteins (IGFBP3 and RBP4) on anti-CD3 activated human CD3 T cells. VSIG-8 significantly reduces the production of IFN-γand IL-2 on both CD4 and CD8 T cells in the presence of T-cell receptor signaling. VSIG-8 markedly suppresses anti-CD3-induced human T cell proliferation and profoundly decreases the conversion of naïve CD4+ T cells into Th1 cells[1][2].

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P0DPA2 (V22-G263)

Gene ID
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
VSIG8; C1orf204
AA Sequence

VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

Predicted Molecular Mass
55.5 kDa
Molecular Weight

Approximately 60-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSIG8 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78787
Quantity:
MCE Japan Authorized Agent: