xynG1 Protein, Paenibacillus sp. (His, Strep)
xynG1 Protein, Paenibacillus sp. (His, Strep) is the recombinant xynG1 protein, expressed by E. coli, with Strep & His tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
xynG1 Protein, Paenibacillus sp. (His, Strep) is the recombinant xynG1 protein, expressed by E. coli, with Strep & His tag.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Strep;His
-
Accession
A0A269WC65 (A29-R366)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Endo-1,4-beta-xylanase; 3.2.1.8; CHH75_00750
-
AA Sequence
ATTITSNEIGTHDGYDYEFWKDSGGSGSMTLNSGGTFSAQWSNINNILFRKGKKFNETQTHQQIGNMSITYGANFQPNGNAYLTVYGWTVDPLVEFYIVDSWGTYRPTGTHKGTINVDGGTYDIYETTRVNQPSIKGTATFKQYWSVRTSKRTSGTISVSEHFRAWESRGMPMGKMYEVAMTVEGYQSSGSANVYSNTLTIGGGNPGGGNPGGGTNPGTVTRVEAESMTKSGQYTGNISSPFNGVALYANNDSVKYTQYFATSTHSFSLRGASNNANMARVDLKIGGQTKGTFYFGGSYPAVYTLNNVSHGTGNQEIELIVTADDGTWDAFIDYLEIR
-
Predicted Molecular Mass
39.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
