ZEB2 Protein, Human
ZEB2 Protein, Human is the recombinant human-derived ZEB2, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ZEB2 Protein, Human is the recombinant human-derived ZEB2, expressed by E. coli , with tag Free labeled tag. ,
Background
ZEB2 is a transcriptional inhibitor that binds to the DNA sequence 5'-CACCT-3' in various promoters. It represses the transcription of E-cadherin (by similar) and downregulates the expression of MEOX2.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O60315-1 (S647-S705)
-
Gene ID9839
-
Protein Length
Partial
-
Synonyms
ZEB2; Zinc Finger E-Box Binding Homeobox 2; ZFHX1B; SIP1; Zinc Finger E-Box-Binding Homeobox 2; Smad-Interacting Protein 1; KIAA0569; SIP-1; Zinc Finger Homeobox Protein 1b; SMAD Interacting Protein 1; Zinc Finger Homeobox 1b; SMADIP1; HSPC082; ZFX1B
-
AA Sequence
SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
-
Predicted Molecular Mass
7.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
