S10 peptide
S10 peptide is an amphipathic peptide delivery agent that comprises an endosomolytic domain linked to a cell-penetrating peptide via a glycine-serine linker. S10 peptide serves as a delivery vehicle through amphipathic peptide-mediated membrane interactions. S10 peptide is used in molecular delivery-related research.
For research use only. We do not sell to patients.
- Formula: C161H272N58O40
- Molecular Weight:3660.25
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
S10 peptide (S10) efficiently delivers peptide and PMO conjugates to HeLa cells; the conjugate form with a disulfide-PEG12 linker exhibits the optimal delivery efficiency, and such conjugates also achieve splice switching and induce EGFP expression in HeLa EGFP-654 cells[1].
S10 peptide (S10) (5-20 μM; 15 min) efficiently delivers GFP-NLS protein to primary ferret airway basal cells and polarized airway epithelium without detectable toxicity[2].
S10 peptide (20 μM; 15 min) enables genomic editing delivery of Cas RNP in ferret airway basal cells and polarized epithelium; and exhibits undetectable toxicity to polarized ferret airway epithelium[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
-
Cell Line:Polarized primary ferret airway ALI epithelia
-
Concentration:20 μM
-
Incubation Time:15 min (RT); 24 h (post-delivery)
-
Result:Showed undetectable toxicity to ferret airway epithelia as assessed by the LDH assay.
In Vivo
S10 peptide-derived S10-SS-PMO and S10-SS-PEG12-PMO (40 µM; intranasal administration; single dose) promote splice switching in lung epithelial cells of CAG-EGFP-654 mice[1].
S10 peptide (intratracheal/intralaryngotracheal; single administration) efficiently delivers proteins, peptides, and Cas9 RNPs to ferret airway epithelium in vivo[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 3660.25
-
Formula C161H272N58O40
-
SMILES
O=C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(NCC(NCC(N[C@@H](CO)C(NCC(NCC(NCC(N[C@@H](CO)C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H]([C@H](O)C)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCCCN)N
-
Sequence
Lys-Trp-Lys-Leu-Ala-Arg-Ala-Phe-Ala-Arg-Ala-Ile-Lys-Lys-Leu-Gly-Gly-Ser-Gly-Gly-Gly-Ser-Tyr-Ala-Arg-Ala-Leu-Arg-Arg-Gln-Ala-Arg-Thr-Gly
-
Sequence Shortening
KWKLARAFARAIKKLGGSGGGSYARALRRQARTG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
S10 peptide Related Classifications
HY-P12339 Related Classifications
Powered by Bioz
Keywords
- S10 peptide
- Amino Acid Derivatives
- Biochemical Assay Reagents
- endosomal leakage domain
- GFP
- CRISPR-associated nuclease ribonucleoprotein
- cystic fibrosis
- base editor RNP
- amphiphilic peptide
- cell-penetrating peptide
- glycine-serine linker
- ferret CFTR-G551 locus
- ROSA-TG Cre/LoxP reporter locus
- Inhibitor
- inhibitor
- inhibit