Ssm spooky toxin TFA
Based on 1 Customer Validation
Ssm Spooky Toxin TFA is found in Scolopendra mutilans that potently inhibits KCNQ (voltage-gated potassium channel family 7) channels, with IC50s of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin TFA inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin TFA plays an essential role in the centipede’s circulatory system .
For research use only. We do not sell to patients.
- Purity: 97.74%
- Formula: C270H413N69O79S4.xC2HF3O2
- Molecular Weight:6017.84 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 6017.84 (free base)
-
Formula C270H413N69O79S4.xC2HF3O2
-
Color White to off-white
-
Synonyms
SsTx Toxin TFA
-
Sequence
Glu-Val-Ile-Lys-Lys-Asp-Thr-Pro-Tyr-Lys-Lys-Arg-Lys-Phe-Pro-Tyr-Lys-Ser-Glu-Cys-Leu-Lys-Ala-Cys-Ala-Thr-Ser-Phe-Thr-Gly-Gly-Asp-Glu-Ser-Arg-Ile-Gln-Glu-Gly-Lys-Pro-Gly-Phe-Phe-Lys-Cys-Thr-Cys-Tyr-Phe-Thr-Thr-Gly (Disulfide bridge: Cys20-Cys46, Cys24-Cys48)
-
Sequence Shortening
EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG (Disulfide bridge: Cys20-Cys46, Cys24-Cys48)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (298 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Canwei Du, et al. Centipede KCNQ Inhibitor SsTx Also Targets KV1.3. Toxins (Basel). 2019 Feb; 11(2): 76. [Content Brief]
[2]. Shilong Yang, et al. Target switch of centipede toxins for antagonistic switch. Sci Adv. 2020 Aug 7;6(32):eabb5734. [Content Brief]
[3]. Anna Luo, et al. Centipede Venom: A Potential Source of Ion Channel Modulators. Int J Mol Sci.2022 Jun 26;23(13):7105. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)