Termicin
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C181H266N58O48S6
- Molecular Weight:4214.80
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
Chemical Information
-
Molecular Weight 4214.80
-
Formel C181H266N58O48S6
-
Sequence
Ala-Cys-Asn-Phe-Gln-Ser-Cys-Trp-Ala-Thr-Cys-Gln-Ala-Gln-His-Ser-Ile-Tyr-Phe-Arg-Arg-Ala-Phe-Cys-Asp-Arg-Ser-Gln-Cys-Lys-Cys-Val-Phe-Val-Arg-Gly-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6)
-
Sequence Shortening
ACNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG-NH2 (Disulfide bridge:C1-C4,C2-C5,C3-C6)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Filamentous Fungal Mold Culture and Sporulation
Filamentous fungal mold culture and sporulation assays grow hyphae under defined nutritional and environmental conditions until asexual spores, commonly conidia, are produced; the main readouts are colony growth, sporulation onset, conidial yield, conidial morphology, viability, and, when relevant, downstream infectivity or stress phenotype.
-
Gram Staining of Tissue Sections
Gram staining of tissue sections is a histochemical technique used to differentiate Gram-positive and Gram-negative bacteria within histological specimens based on differences in bacterial cell wall structure and dye retention, adapted from classical bacteriological Gram staining into tissue-compatible “histological Gram stain” variants. In tissue applications, modifications of the Brown-Hopps and Brown-Brenn methods are commonly used to improve differentiation of microorganisms embedded within host connective tissue and to reduce overstaining or loss of Gram-negative signal, which are known limitations of earlier approaches. The principle relies on crystal violet-iodine complex retention in Gram-positive organisms and subsequent decolorization and counterstaining steps that allow contrast visualization of Gram-negative organisms against tissue background.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)